ARHGEF6,alpha-PIX
  • ARHGEF6,alpha-PIX

Anti-ARHGEF6 Antibody 100ul

Ref: AN-HPA003578-100ul
Anti-ARHGEF6

Información del producto

Polyclonal Antibody against Human ARHGEF6, Gene description: Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6, Alternative Gene Names: alpha-PIX, alphaPIX, Cool-2, Cool2, KIAA0006, MRX46, Validated applications: ICC, IHC, WB, Uniprot ID: Q15052, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ARHGEF6
Gene Description Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence VQYGACEEKEERYLMLFSNVLIMLSASPRMSGFIYQGKIPIAGTVVTRLDEIEGNDCTFEITGNTVERIVVHCNNNQDFQEWLEQLNRLIRGPASCSSLSKTSSSSCSAHS
Immunogen VQYGACEEKEERYLMLFSNVLIMLSASPRMSGFIYQGKIPIAGTVVTRLDEIEGNDCTFEITGNTVERIVVHCNNNQDFQEWLEQLNRLIRGPASCSSLSKTSSSSCSAHS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names alpha-PIX, alphaPIX, Cool-2, Cool2, KIAA0006, MRX46
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15052
HTS Code 3002150000
Gene ID 9459
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ARHGEF6 Antibody 100ul

Anti-ARHGEF6 Antibody 100ul