CHCHD10,C22orf16
  • CHCHD10,C22orf16

Anti-CHCHD10 Antibody 100ul

Ref: AN-HPA003440-100ul
Anti-CHCHD10

Información del producto

Polyclonal Antibody against Human CHCHD10, Gene description: coiled-coil-helix-coiled-coil-helix domain containing 10, Alternative Gene Names: C22orf16, N27C7-4, Validated applications: ICC, IHC, WB, Uniprot ID: Q8WYQ3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CHCHD10
Gene Description coiled-coil-helix-coiled-coil-helix domain containing 10
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence GLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP
Immunogen GLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C22orf16, N27C7-4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WYQ3
HTS Code 3002150000
Gene ID 400916
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CHCHD10 Antibody 100ul

Anti-CHCHD10 Antibody 100ul