VSX2,CHX10,HOX10
  • VSX2,CHX10,HOX10

Anti-VSX2 Antibody 100ul

Ref: AN-HPA003436-100ul
Anti-VSX2

Información del producto

Polyclonal Antibody against Human VSX2, Gene description: visual system homeobox 2, Alternative Gene Names: CHX10, HOX10, RET1, Validated applications: IHC, WB, Uniprot ID: P58304, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name VSX2
Gene Description visual system homeobox 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Rat
Applications WB, IHC
Sequence LGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAH
Immunogen LGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CHX10, HOX10, RET1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P58304
HTS Code 3002150000
Gene ID 338917
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-VSX2 Antibody 100ul

Anti-VSX2 Antibody 100ul