GZMB,CCPI,CGL-1
  • GZMB,CCPI,CGL-1

Anti-GZMB Antibody 100ul

Ref: AN-HPA003418-100ul
Anti-GZMB

Información del producto

Polyclonal Antibody against Human GZMB, Gene description: granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1), Alternative Gene Names: CCPI, CGL-1, CGL1, CSP-B, CSPB, CTLA1, CTSGL1, HLP, SECT, Validated applications: IHC, WB, Uniprot ID: P10144, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GZMB
Gene Description granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence TRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSS
Immunogen TRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CCPI, CGL-1, CGL1, CSP-B, CSPB, CTLA1, CTSGL1, HLP, SECT
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P10144
HTS Code 3002150000
Gene ID 3002
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GZMB Antibody 100ul

Anti-GZMB Antibody 100ul