IFIT2,cig42,G10P2
  • IFIT2,cig42,G10P2

Anti-IFIT2 Antibody 25ul

Ref: AN-HPA003408-25ul
Anti-IFIT2

Información del producto

Polyclonal Antibody against Human IFIT2, Gene description: interferon-induced protein with tetratricopeptide repeats 2, Alternative Gene Names: cig42, G10P2, GARG-39, IFI-54, IFI54, ISG-54K, Validated applications: IHC, Uniprot ID: P09913, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IFIT2
Gene Description interferon-induced protein with tetratricopeptide repeats 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RVCSILASLHALADQYEDAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQKSREKEKMKDKLQKIAKMRLSKNGADSEALHVLAFLQELNEKMQQADEDSERGLESGS
Immunogen RVCSILASLHALADQYEDAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQKSREKEKMKDKLQKIAKMRLSKNGADSEALHVLAFLQELNEKMQQADEDSERGLESGS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names cig42, G10P2, GARG-39, IFI-54, IFI54, ISG-54K
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P09913
HTS Code 3002150000
Gene ID 3433
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IFIT2 Antibody 25ul

Anti-IFIT2 Antibody 25ul