FBXO44,FBG3,FBX30
  • FBXO44,FBG3,FBX30

Anti-FBXO44 Antibody 25ul

Ref: AN-HPA003363-25ul
Anti-FBXO44

Información del producto

Polyclonal Antibody against Human FBXO44, Gene description: F-box protein 44, Alternative Gene Names: FBG3, FBX30, Fbx44, Fbxo6a, MGC14140, Validated applications: ICC, IHC, WB, Uniprot ID: Q9H4M3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FBXO44
Gene Description F-box protein 44
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence SLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQVRSQARLRVQVPAVRSAPVVRARASGDLPARPGDHPAEERCQVEGGLPHILQLP
Immunogen SLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQVRSQARLRVQVPAVRSAPVVRARASGDLPARPGDHPAEERCQVEGGLPHILQLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FBG3, FBX30, Fbx44, Fbxo6a, MGC14140
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H4M3
HTS Code 3002150000
Gene ID 93611
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FBXO44 Antibody 25ul

Anti-FBXO44 Antibody 25ul