RHOXF2,CT107,PEPP-2
  • RHOXF2,CT107,PEPP-2

Anti-RHOXF2 Antibody 100ul

Ref: AN-HPA003314-100ul
Anti-RHOXF2

Información del producto

Polyclonal Antibody against Human RHOXF2, Gene description: Rhox homeobox family, member 2, Alternative Gene Names: CT107, PEPP-2, PEPP2, THG1, Validated applications: IHC, Uniprot ID: Q9BQY4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RHOXF2
Gene Description Rhox homeobox family, member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQ
Immunogen DQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT107, PEPP-2, PEPP2, THG1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BQY4
HTS Code 3002150000
Gene ID 84528
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RHOXF2 Antibody 100ul

Anti-RHOXF2 Antibody 100ul