ZNF143,pHZ-1,SBF
  • ZNF143,pHZ-1,SBF

Anti-ZNF143 Antibody 100ul

Ref: AN-HPA003263-100ul
Anti-ZNF143

Información del producto

Polyclonal Antibody against Human ZNF143, Gene description: zinc finger protein 143, Alternative Gene Names: pHZ-1, SBF, STAF, Validated applications: IHC, Uniprot ID: P52747, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZNF143
Gene Description zinc finger protein 143
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TQSGLSQQVTLISQDGTQHVNISQADMQAIGNTITMVTQDGTPITVPAHDAVISSAGTHSVAMVTAEGTEGQQVAIVAQDLAAFHTASSEMGHQQHSHHLVTTETRPLTLVATSNGTQIAVQLGEQPSLEEAIRIASRIQQGET
Immunogen TQSGLSQQVTLISQDGTQHVNISQADMQAIGNTITMVTQDGTPITVPAHDAVISSAGTHSVAMVTAEGTEGQQVAIVAQDLAAFHTASSEMGHQQHSHHLVTTETRPLTLVATSNGTQIAVQLGEQPSLEEAIRIASRIQQGET
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names pHZ-1, SBF, STAF
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P52747
HTS Code 3002150000
Gene ID 7702
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF143 Antibody 100ul

Anti-ZNF143 Antibody 100ul