GABPA,E4TF1-60
  • GABPA,E4TF1-60

Anti-GABPA Antibody 25ul

Ref: AN-HPA003258-25ul
Anti-GABPA

Información del producto

Polyclonal Antibody against Human GABPA, Gene description: GA binding protein transcription factor, alpha subunit 60kDa, Alternative Gene Names: E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A, Validated applications: ICC, IHC, WB, Uniprot ID: Q06546, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GABPA
Gene Description GA binding protein transcription factor, alpha subunit 60kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence EELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTVEVVIDPDAHHAESEAHLVEEAQVITLDGTK
Immunogen EELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTVEVVIDPDAHHAESEAHLVEEAQVITLDGTK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q06546
HTS Code 3002150000
Gene ID 2551
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GABPA Antibody 25ul

Anti-GABPA Antibody 25ul