ZNF155,pHZ-96
  • ZNF155,pHZ-96

Anti-ZNF155 Antibody 100ul

Ref: AN-HPA003220-100ul
Anti-ZNF155

Información del producto

Polyclonal Antibody against Human ZNF155, Gene description: zinc finger protein 155, Alternative Gene Names: pHZ-96, Validated applications: ICC, IHC, WB, Uniprot ID: Q12901, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZNF155
Gene Description zinc finger protein 155
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence TCHFLREEKFWMMGTATQREGNSGGKIQTELESVPEAGAHEEWSCQQIWEQIAKDLTRSQDSIINNSQFFENGDVPSQVEAGLPTIHTGQKPSQGGKCKQSFSDVPIFDLPQ
Immunogen TCHFLREEKFWMMGTATQREGNSGGKIQTELESVPEAGAHEEWSCQQIWEQIAKDLTRSQDSIINNSQFFENGDVPSQVEAGLPTIHTGQKPSQGGKCKQSFSDVPIFDLPQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names pHZ-96
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12901
HTS Code 3002150000
Gene ID 7711
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF155 Antibody 100ul

Anti-ZNF155 Antibody 100ul