TSPAN7,A15,CD231
  • TSPAN7,A15,CD231

Anti-TSPAN7 Antibody 25ul

Ref: AN-HPA003140-25ul
Anti-TSPAN7

Información del producto

Polyclonal Antibody against Human TSPAN7, Gene description: tetraspanin 7, Alternative Gene Names: A15, CD231, DXS1692E, MRX58, MXS1, TALLA-1, TM4SF2, Validated applications: IHC, WB, Uniprot ID: P41732, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TSPAN7
Gene Description tetraspanin 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET
Immunogen TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names A15, CD231, DXS1692E, MRX58, MXS1, TALLA-1, TM4SF2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P41732
HTS Code 3002150000
Gene ID 7102
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TSPAN7 Antibody 25ul

Anti-TSPAN7 Antibody 25ul