ZAP70,SRK,STD,ZAP-70
  • ZAP70,SRK,STD,ZAP-70

Anti-ZAP70 Antibody 100ul

Ref: AN-HPA003134-100ul
Anti-ZAP70

Información del producto

Polyclonal Antibody against Human ZAP70, Gene description: zeta-chain (TCR) associated protein kinase 70kDa, Alternative Gene Names: SRK, STD, ZAP-70, Validated applications: IHC, WB, Uniprot ID: P43403, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZAP70
Gene Description zeta-chain (TCR) associated protein kinase 70kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence LIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHPQRRIDTLNSDGYTPEPARITSPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMR
Immunogen LIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHPQRRIDTLNSDGYTPEPARITSPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SRK, STD, ZAP-70
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P43403
HTS Code 3002150000
Gene ID 7535
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZAP70 Antibody 100ul

Anti-ZAP70 Antibody 100ul