SULT4A1,hBR-STL-1
  • SULT4A1,hBR-STL-1

Anti-SULT4A1 Antibody 25ul

Ref: AN-HPA003129-25ul
Anti-SULT4A1

Información del producto

Polyclonal Antibody against Human SULT4A1, Gene description: sulfotransferase family 4A, member 1, Alternative Gene Names: hBR-STL-1, SULTX3, Validated applications: IHC, WB, Uniprot ID: Q9BR01, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SULT4A1
Gene Description sulfotransferase family 4A, member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence GEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSL
Immunogen GEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hBR-STL-1, SULTX3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BR01
HTS Code 3002150000
Gene ID 25830
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SULT4A1 Antibody 25ul

Anti-SULT4A1 Antibody 25ul