COX8C,COX8-3
  • COX8C,COX8-3

Anti-COX8C Antibody 100ul

Ref: AN-HPA003127-100ul
Anti-COX8C

Información del producto

Polyclonal Antibody against Human COX8C, Gene description: cytochrome c oxidase subunit VIIIC, Alternative Gene Names: COX8-3, Validated applications: IHC, WB, Uniprot ID: Q7Z4L0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name COX8C
Gene Description cytochrome c oxidase subunit VIIIC
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAE
Immunogen MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names COX8-3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z4L0
HTS Code 3002150000
Gene ID 341947
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-COX8C Antibody 100ul

Anti-COX8C Antibody 100ul