RHOJ,ARHJ,FLJ14445
  • RHOJ,ARHJ,FLJ14445

Anti-RHOJ Antibody 25ul

Ref: AN-HPA003050-25ul
Anti-RHOJ

Información del producto

Polyclonal Antibody against Human RHOJ, Gene description: ras homolog family member J, Alternative Gene Names: ARHJ, FLJ14445, RASL7B, TCL, Validated applications: IHC, WB, Uniprot ID: Q9H4E5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RHOJ
Gene Description ras homolog family member J
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence CFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEG
Immunogen CFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARHJ, FLJ14445, RASL7B, TCL
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H4E5
HTS Code 3002150000
Gene ID 57381
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RHOJ Antibody 25ul

Anti-RHOJ Antibody 25ul