ASB9,DKFZP564L0862
  • ASB9,DKFZP564L0862

Anti-ASB9 Antibody 100ul

Ref: AN-HPA003014-100ul
Anti-ASB9

Información del producto

Polyclonal Antibody against Human ASB9, Gene description: ankyrin repeat and SOCS box containing 9, Alternative Gene Names: DKFZP564L0862, FLJ20636, MGC4954, Validated applications: IHC, WB, Uniprot ID: Q96DX5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ASB9
Gene Description ankyrin repeat and SOCS box containing 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence GMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGWAVNIITADHVSPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACV
Immunogen GMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGWAVNIITADHVSPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP564L0862, FLJ20636, MGC4954
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96DX5
HTS Code 3002150000
Gene ID 140462
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ASB9 Antibody 100ul

Anti-ASB9 Antibody 100ul