CSPG4,HMW-MAA,MCSP
  • CSPG4,HMW-MAA,MCSP

Anti-CSPG4 Antibody 100ul

Ref: AN-HPA002951-100ul
Anti-CSPG4

Información del producto

Polyclonal Antibody against Human CSPG4, Gene description: chondroitin sulfate proteoglycan 4, Alternative Gene Names: HMW-MAA, MCSP, MCSPG, MEL-CSPG, MSK16, NG2, Validated applications: IHC, WB, Uniprot ID: Q6UVK1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CSPG4
Gene Description chondroitin sulfate proteoglycan 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence ILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFRAHL
Immunogen ILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFRAHL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HMW-MAA, MCSP, MCSPG, MEL-CSPG, MSK16, NG2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6UVK1
HTS Code 3002150000
Gene ID 1464
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CSPG4 Antibody 100ul

Anti-CSPG4 Antibody 100ul