TRAF3,CAP-1,CD40bp
  • TRAF3,CAP-1,CD40bp

Anti-TRAF3 Antibody 25ul

Ref: AN-HPA002933-25ul
Anti-TRAF3

Información del producto

Polyclonal Antibody against Human TRAF3, Gene description: TNF receptor-associated factor 3, Alternative Gene Names: CAP-1, CD40bp, CRAF1, LAP1, Validated applications: IHC, Uniprot ID: Q13114, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TRAF3
Gene Description TNF receptor-associated factor 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLTLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVV
Immunogen SSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLTLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CAP-1, CD40bp, CRAF1, LAP1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13114
HTS Code 3002150000
Gene ID 7187
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TRAF3 Antibody 25ul

Anti-TRAF3 Antibody 25ul