TIMM9,TIM9A
  • TIMM9,TIM9A

Anti-TIMM9 Antibody 100ul

Ref: AN-HPA002932-100ul
Anti-TIMM9

Información del producto

Polyclonal Antibody against Human TIMM9, Gene description: translocase of inner mitochondrial membrane 9 homolog (yeast), Alternative Gene Names: TIM9A, Validated applications: ICC, IHC, Uniprot ID: Q9Y5J7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TIMM9
Gene Description translocase of inner mitochondrial membrane 9 homolog (yeast)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence AAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
Immunogen AAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TIM9A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5J7
HTS Code 3002150000
Gene ID 26520
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TIMM9 Antibody 100ul

Anti-TIMM9 Antibody 100ul