ENTPD5,CD39L4
  • ENTPD5,CD39L4

Anti-ENTPD5 Antibody 100ul

Ref: AN-HPA002927-100ul
Anti-ENTPD5

Información del producto

Polyclonal Antibody against Human ENTPD5, Gene description: ectonucleoside triphosphate diphosphohydrolase 5, Alternative Gene Names: CD39L4, NTPDase-5, PCPH, Validated applications: IHC, WB, Uniprot ID: O75356, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ENTPD5
Gene Description ectonucleoside triphosphate diphosphohydrolase 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence AGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTL
Immunogen AGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD39L4, NTPDase-5, PCPH
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75356
HTS Code 3002150000
Gene ID 957
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ENTPD5 Antibody 100ul

Anti-ENTPD5 Antibody 100ul