ABHD12B,BEM46L3
  • ABHD12B,BEM46L3

Anti-ABHD12B Antibody 100ul

Ref: AN-HPA002873-100ul
Anti-ABHD12B

Información del producto

Polyclonal Antibody against Human ABHD12B, Gene description: abhydrolase domain containing 12B, Alternative Gene Names: BEM46L3, C14orf29, Validated applications: IHC, WB, Uniprot ID: Q7Z5M8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ABHD12B
Gene Description abhydrolase domain containing 12B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence LGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIVFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFLSKQ
Immunogen LGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIVFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFLSKQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BEM46L3, C14orf29
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z5M8
HTS Code 3002150000
Gene ID 145447
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ABHD12B Antibody 100ul

Anti-ABHD12B Antibody 100ul