BIRC5,API4,EPR-1
  • BIRC5,API4,EPR-1

Anti-BIRC5 Antibody 100ul

Ref: AN-HPA002830-100ul
Anti-BIRC5

Información del producto

Polyclonal Antibody against Human BIRC5, Gene description: baculoviral IAP repeat containing 5, Alternative Gene Names: API4, EPR-1, survivin, Validated applications: IHC, WB, Uniprot ID: , Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name BIRC5
Gene Description baculoviral IAP repeat containing 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETA
Immunogen MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names API4, EPR-1, survivin
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
HTS Code 3002150000
Gene ID 332
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-BIRC5 Antibody 100ul

Anti-BIRC5 Antibody 100ul