CDC34,E2-CDC34,UBC3
  • CDC34,E2-CDC34,UBC3

Anti-CDC34 Antibody 25ul

Ref: AN-HPA002382-25ul
Anti-CDC34

Información del producto

Polyclonal Antibody against Human CDC34, Gene description: cell division cycle 34, Alternative Gene Names: E2-CDC34, UBC3, UBE2R1, Validated applications: ICC, IHC, WB, Uniprot ID: P49427, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CDC34
Gene Description cell division cycle 34
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB, ICC
Sequence LNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGT
Immunogen LNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names E2-CDC34, UBC3, UBE2R1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P49427
HTS Code 3002150000
Gene ID 997
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CDC34 Antibody 25ul

Anti-CDC34 Antibody 25ul