DPYSL2,CRMP2,DHPRP2
  • DPYSL2,CRMP2,DHPRP2

Anti-DPYSL2 Antibody 25ul

Ref: AN-HPA002381-25ul
Anti-DPYSL2

Información del producto

Polyclonal Antibody against Human DPYSL2, Gene description: dihydropyrimidinase-like 2, Alternative Gene Names: CRMP2, DHPRP2, DRP-2, DRP2, Validated applications: ICC, IHC, WB, Uniprot ID: Q16555, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DPYSL2
Gene Description dihydropyrimidinase-like 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence DFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSR
Immunogen DFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CRMP2, DHPRP2, DRP-2, DRP2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q16555
HTS Code 3002150000
Gene ID 1808
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DPYSL2 Antibody 25ul

Anti-DPYSL2 Antibody 25ul