PUM3,HA-8,hPUF-A
  • PUM3,HA-8,hPUF-A

Anti-PUM3 Antibody 25ul

Ref: AN-HPA002353-25ul
Anti-PUM3

Información del producto

Polyclonal Antibody against Human PUM3, Gene description: pumilio RNA-binding family member 3, Alternative Gene Names: HA-8, hPUF-A, KIAA0020, PEN, PUF6, XTP5, Validated applications: ICC, IHC, WB, Uniprot ID: Q15397, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PUM3
Gene Description pumilio RNA-binding family member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence EHAQEVVLDKSACVLVSDILGSATGDVQPTMNAIASLAATGLHPGGKDGELHIAEHPAGHLVLKWLIEQDKKMKENGREGCFAKTLVEHVGMKNLKSWASVNRGAIILSSLLQSCDLEVANKVKAALKSLIPTLEKTKSTSKGI
Immunogen EHAQEVVLDKSACVLVSDILGSATGDVQPTMNAIASLAATGLHPGGKDGELHIAEHPAGHLVLKWLIEQDKKMKENGREGCFAKTLVEHVGMKNLKSWASVNRGAIILSSLLQSCDLEVANKVKAALKSLIPTLEKTKSTSKGI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HA-8, hPUF-A, KIAA0020, PEN, PUF6, XTP5
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15397
HTS Code 3002150000
Gene ID 9933
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PUM3 Antibody 25ul

Anti-PUM3 Antibody 25ul