PLVAP,FELS,gp68
  • PLVAP,FELS,gp68

Anti-PLVAP Antibody 25ul

Ref: AN-HPA002279-25ul
Anti-PLVAP

Información del producto

Polyclonal Antibody against Human PLVAP, Gene description: plasmalemma vesicle associated protein, Alternative Gene Names: FELS, gp68, PV-1, PV1, Validated applications: IHC, Uniprot ID: Q9BX97, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PLVAP
Gene Description plasmalemma vesicle associated protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRSLDNLGYNLYHPLGSELASIRRACDHMPSLMSSKVEELARSLRADIERVARENSDLQRQKLEAQQGLRASQEAKQKVEKEAQAREAKLQAECSR
Immunogen KEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRSLDNLGYNLYHPLGSELASIRRACDHMPSLMSSKVEELARSLRADIERVARENSDLQRQKLEAQQGLRASQEAKQKVEKEAQAREAKLQAECSR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FELS, gp68, PV-1, PV1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BX97
HTS Code 3002150000
Gene ID 83483
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PLVAP Antibody 25ul

Anti-PLVAP Antibody 25ul