ERLIN2,C8orf2
  • ERLIN2,C8orf2

Anti-ERLIN2 Antibody 100ul

Ref: AN-HPA002025-100ul
Anti-ERLIN2

Información del producto

Polyclonal Antibody against Human ERLIN2, Gene description: ER lipid raft associated 2, Alternative Gene Names: C8orf2, Erlin-2, NET32, SPFH2, SPG18, Validated applications: ICC, IHC, WB, Uniprot ID: O94905, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ERLIN2
Gene Description ER lipid raft associated 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence KTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKKISEIEDAAFLAREKAKADAECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATK
Immunogen KTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKKISEIEDAAFLAREKAKADAECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C8orf2, Erlin-2, NET32, SPFH2, SPG18
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O94905
HTS Code 3002150000
Gene ID 11160
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ERLIN2 Antibody 100ul

Anti-ERLIN2 Antibody 100ul