TFAP4,AP-4,bHLHc41
  • TFAP4,AP-4,bHLHc41
Atlas Antibodies

Anti-TFAP4 Antibody 25ul

Ref: AN-HPA001912-25ul
Anti-TFAP4

Información del producto

Polyclonal Antibody against Human TFAP4, Gene description: transcription factor AP-4 (activating enhancer binding protein 4), Alternative Gene Names: AP-4, bHLHc41, Validated applications: ICC, IHC, Uniprot ID: Q01664, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TFAP4
Gene Description transcription factor AP-4 (activating enhancer binding protein 4)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence YFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEK
Immunogen YFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AP-4, bHLHc41
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q01664
HTS Code 3002150000
Gene ID 7023
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje

Anti-TFAP4 Antibody 25ul

Anti-TFAP4 Antibody 25ul