UPF3B,HUPF3B,MRX62
  • UPF3B,HUPF3B,MRX62

Anti-UPF3B Antibody 100ul

Ref: AN-HPA001800-100ul
Anti-UPF3B

Información del producto

Polyclonal Antibody against Human UPF3B, Gene description: UPF3 regulator of nonsense transcripts homolog B (yeast), Alternative Gene Names: HUPF3B, MRX62, RENT3B, UPF3X, Validated applications: IHC, WB, Uniprot ID: Q9BZI7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name UPF3B
Gene Description UPF3 regulator of nonsense transcripts homolog B (yeast)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence AKKLDKENLSDERASGQSCTLPKRSDSELKDEKPKRPEDESGRDYREREREYERDQERILRERERLKRQEEERRRQKERYEKEKTFKRKEEEMKKEKDTLRDKGKKAESTESIGSSEKTEKKEEVVKRDRIRNKDR
Immunogen AKKLDKENLSDERASGQSCTLPKRSDSELKDEKPKRPEDESGRDYREREREYERDQERILRERERLKRQEEERRRQKERYEKEKTFKRKEEEMKKEKDTLRDKGKKAESTESIGSSEKTEKKEEVVKRDRIRNKDR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HUPF3B, MRX62, RENT3B, UPF3X
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BZI7
HTS Code 3002150000
Gene ID 65109
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-UPF3B Antibody 100ul

Anti-UPF3B Antibody 100ul