DLG3,KIAA1232,MRX90
  • DLG3,KIAA1232,MRX90

Anti-DLG3 Antibody 25ul

Ref: AN-HPA001733-25ul
Anti-DLG3

Información del producto

Polyclonal Antibody against Human DLG3, Gene description: discs, large homolog 3 (Drosophila), Alternative Gene Names: KIAA1232, MRX90, NE-Dlg, NEDLG, PPP1R82, SAP-102, SAP102, Validated applications: IHC, WB, Uniprot ID: Q92796, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DLG3
Gene Description discs, large homolog 3 (Drosophila)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence HKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPGGGNGASAGYGGYSSQTLPSQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD
Immunogen HKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPGGGNGASAGYGGYSSQTLPSQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1232, MRX90, NE-Dlg, NEDLG, PPP1R82, SAP-102, SAP102
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92796
HTS Code 3002150000
Gene ID 1741
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DLG3 Antibody 25ul

Anti-DLG3 Antibody 25ul