RBM22,Cwc2,FLJ10290
  • RBM22,Cwc2,FLJ10290

Anti-RBM22 Antibody 25ul

Ref: AN-HPA001634-25ul
Anti-RBM22

Información del producto

Polyclonal Antibody against Human RBM22, Gene description: RNA binding motif protein 22, Alternative Gene Names: Cwc2, FLJ10290, fSAP47, ZC3H16, Validated applications: ICC, IHC, Uniprot ID: Q9NW64, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RBM22
Gene Description RNA binding motif protein 22
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence NTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKL
Immunogen NTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Cwc2, FLJ10290, fSAP47, ZC3H16
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NW64
HTS Code 3002150000
Gene ID 55696
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RBM22 Antibody 25ul

Anti-RBM22 Antibody 25ul