HNRNPA1,hnRNP-A1
  • HNRNPA1,hnRNP-A1

Anti-HNRNPA1 Antibody 100ul

Ref: AN-HPA001609-100ul
Anti-HNRNPA1

Información del producto

Polyclonal Antibody against Human HNRNPA1, Gene description: heterogeneous nuclear ribonucleoprotein A1, Alternative Gene Names: hnRNP-A1, hnRNPA1, HNRPA1, Validated applications: IHC, WB, Uniprot ID: P09651, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HNRNPA1
Gene Description heterogeneous nuclear ribonucleoprotein A1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence ETTDESLRSHFERWGMLTDCAVMRDPNTKRSRGFGFVTYATVEEVDAATNARPHKVDGKVVEPRRTVSREDYQRSGAHLTVKKIFVGGIKENTEKHQLRDYFEQHGKMEVIEIMTEAVARKGALPL
Immunogen ETTDESLRSHFERWGMLTDCAVMRDPNTKRSRGFGFVTYATVEEVDAATNARPHKVDGKVVEPRRTVSREDYQRSGAHLTVKKIFVGGIKENTEKHQLRDYFEQHGKMEVIEIMTEAVARKGALPL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hnRNP-A1, hnRNPA1, HNRPA1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P09651
HTS Code 3002150000
Gene ID 3178
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HNRNPA1 Antibody 100ul

Anti-HNRNPA1 Antibody 100ul