G2E3,FLJ20333
  • G2E3,FLJ20333

Anti-G2E3 Antibody 100ul

Ref: AN-HPA001601-100ul
Anti-G2E3

Información del producto

Polyclonal Antibody against Human G2E3, Gene description: G2/M-phase specific E3 ubiquitin protein ligase, Alternative Gene Names: FLJ20333, KIAA1333, PHF7B, Validated applications: IHC, Uniprot ID: Q7L622, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name G2E3
Gene Description G2/M-phase specific E3 ubiquitin protein ligase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence IQAYPEAFCSILCHKPESLSAKILSELFTVHTLPDVKALGFWNSYLQAVEDGKSTTTMEDILIFATGCSSIPPAGFKPTPSIECLHVDFPVGNKCNNCLAIPITNTYKEFQENMDFTIRNT
Immunogen IQAYPEAFCSILCHKPESLSAKILSELFTVHTLPDVKALGFWNSYLQAVEDGKSTTTMEDILIFATGCSSIPPAGFKPTPSIECLHVDFPVGNKCNNCLAIPITNTYKEFQENMDFTIRNT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20333, KIAA1333, PHF7B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7L622
HTS Code 3002150000
Gene ID 55632
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-G2E3 Antibody 100ul

Anti-G2E3 Antibody 100ul