ZNF133,pHZ-13
  • ZNF133,pHZ-13

Anti-ZNF133 Antibody 25ul

Ref: AN-HPA001493-25ul
Anti-ZNF133

Información del producto

Polyclonal Antibody against Human ZNF133, Gene description: zinc finger protein 133, Alternative Gene Names: pHZ-13, pHZ-66, ZNF150, Validated applications: ICC, IHC, Uniprot ID: P52736, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZNF133
Gene Description zinc finger protein 133
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence SKPELITQLEQGKETWREEKKCSPATCPADPEPELYLDPFCPPGFSSQKFPMQHVLCNHPPWIFTCLCAEGNIQPGDPGPGDQEKQQQASEGRPWSDQAEGPEGEGAMPLFGRTKKRTLG
Immunogen SKPELITQLEQGKETWREEKKCSPATCPADPEPELYLDPFCPPGFSSQKFPMQHVLCNHPPWIFTCLCAEGNIQPGDPGPGDQEKQQQASEGRPWSDQAEGPEGEGAMPLFGRTKKRTLG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names pHZ-13, pHZ-66, ZNF150
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P52736
HTS Code 3002150000
Gene ID 7692
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF133 Antibody 25ul

Anti-ZNF133 Antibody 25ul