NBN,AT-V1,AT-V2,ATV
  • NBN,AT-V1,AT-V2,ATV

Anti-NBN Antibody 25ul

Ref: AN-HPA001429-25ul
Anti-NBN

Información del producto

Polyclonal Antibody against Human NBN, Gene description: nibrin, Alternative Gene Names: AT-V1, AT-V2, ATV, NBS, NBS1, Validated applications: IHC, WB, Uniprot ID: O60934, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NBN
Gene Description nibrin
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence DTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDL
Immunogen DTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AT-V1, AT-V2, ATV, NBS, NBS1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60934
HTS Code 3002150000
Gene ID 4683
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NBN Antibody 25ul

Anti-NBN Antibody 25ul