C22orf29,FLJ21125
  • C22orf29,FLJ21125

Anti-C22orf29 Antibody 100ul

Ref: AN-HPA001419-100ul
Anti-C22orf29

Información del producto

Polyclonal Antibody against Human C22orf29, Gene description: chromosome 22 open reading frame 29, Alternative Gene Names: FLJ21125, Validated applications: IHC, WB, Uniprot ID: Q7L3V2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C22orf29
Gene Description chromosome 22 open reading frame 29
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence PRSLPAAMATPAVSGSNSVSRSALFEQQLTKESTPGPKEPPVLPSSTCSSKPGPVEPASSQPEEAAPTPVPRLSESANPPAQRPDPAHPGGPKPQKTEEEVLETEGDQEVSLGTPQEVVEAPETPGEPPLSP
Immunogen PRSLPAAMATPAVSGSNSVSRSALFEQQLTKESTPGPKEPPVLPSSTCSSKPGPVEPASSQPEEAAPTPVPRLSESANPPAQRPDPAHPGGPKPQKTEEEVLETEGDQEVSLGTPQEVVEAPETPGEPPLSP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ21125
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7L3V2
HTS Code 3002150000
Gene ID 79680
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C22orf29 Antibody 100ul

Anti-C22orf29 Antibody 100ul