FLOT2,ECS-1,ECS1
  • FLOT2,ECS-1,ECS1

Anti-FLOT2 Antibody 25ul

Ref: AN-HPA001396-25ul
Anti-FLOT2

Información del producto

Polyclonal Antibody against Human FLOT2, Gene description: flotillin 2, Alternative Gene Names: ECS-1, ECS1, ESA, ESA1, M17S1, Validated applications: IHC, WB, Uniprot ID: Q14254, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FLOT2
Gene Description flotillin 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence ECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRK
Immunogen ECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ECS-1, ECS1, ESA, ESA1, M17S1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14254
HTS Code 3002150000
Gene ID 2319
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FLOT2 Antibody 25ul

Anti-FLOT2 Antibody 25ul