CASP8,Casp-8,FLICE
  • CASP8,Casp-8,FLICE

Anti-CASP8 Antibody 25ul

Ref: AN-HPA001302-25ul
Anti-CASP8

Información del producto

Polyclonal Antibody against Human CASP8, Gene description: caspase 8, apoptosis-related cysteine peptidase, Alternative Gene Names: Casp-8, FLICE, MACH, MCH5, Validated applications: ICC, IHC, WB, Uniprot ID: Q14790, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CASP8
Gene Description caspase 8, apoptosis-related cysteine peptidase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence GIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQP
Immunogen GIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Casp-8, FLICE, MACH, MCH5
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14790
HTS Code 3002150000
Gene ID 841
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CASP8 Antibody 25ul

Anti-CASP8 Antibody 25ul