IKBKB,IKK-beta,IKK2
  • IKBKB,IKK-beta,IKK2

Anti-IKBKB Antibody 25ul

Ref: AN-HPA001249-25ul
Anti-IKBKB

Información del producto

Polyclonal Antibody against Human IKBKB, Gene description: inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta, Alternative Gene Names: IKK-beta, IKK2, IKKB, NFKBIKB, Validated applications: ICC, IHC, WB, Uniprot ID: O14920, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IKBKB
Gene Description inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence PNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRNLAFFQLRKVWGQVWH
Immunogen PNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRNLAFFQLRKVWGQVWH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IKK-beta, IKK2, IKKB, NFKBIKB
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14920
HTS Code 3002150000
Gene ID 3551
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IKBKB Antibody 25ul

Anti-IKBKB Antibody 25ul