DGCR14,DGCR13,DGS-H
  • DGCR14,DGCR13,DGS-H

Anti-DGCR14 Antibody 100ul

Ref: AN-HPA001222-100ul
Anti-DGCR14

Información del producto

Polyclonal Antibody against Human DGCR14, Gene description: DiGeorge syndrome critical region gene 14, Alternative Gene Names: DGCR13, DGS-H, DGSI, ES2, Es2el, Validated applications: IHC, WB, Uniprot ID: Q96DF8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DGCR14
Gene Description DiGeorge syndrome critical region gene 14
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence LRVEGSETPYVDRTPGPAFKILEPGRRERLGLKMANEAAAKNRAKKQEALRRVTENLASLTPKGLSPAMSPALQRLVSRTASKYTDRALRASYTPSPARSTHLKTPASGLQTPTSTPAPGSATRTPLTQDPASITDNL
Immunogen LRVEGSETPYVDRTPGPAFKILEPGRRERLGLKMANEAAAKNRAKKQEALRRVTENLASLTPKGLSPAMSPALQRLVSRTASKYTDRALRASYTPSPARSTHLKTPASGLQTPTSTPAPGSATRTPLTQDPASITDNL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DGCR13, DGS-H, DGSI, ES2, Es2el
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96DF8
HTS Code 3002150000
Gene ID 8220
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DGCR14 Antibody 100ul

Anti-DGCR14 Antibody 100ul