PIK3R1,GRB1,p85
  • PIK3R1,GRB1,p85

Anti-PIK3R1 Antibody 25ul

Ref: AN-HPA001216-25ul
Anti-PIK3R1

Información del producto

Polyclonal Antibody against Human PIK3R1, Gene description: phosphoinositide-3-kinase, regulatory subunit 1 (alpha), Alternative Gene Names: GRB1, p85, p85-ALPHA, Validated applications: ICC, IHC, WB, Uniprot ID: P27986, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PIK3R1
Gene Description phosphoinositide-3-kinase, regulatory subunit 1 (alpha)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence LADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSL
Immunogen LADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GRB1, p85, p85-ALPHA
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P27986
HTS Code 3002150000
Gene ID 5295
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PIK3R1 Antibody 25ul

Anti-PIK3R1 Antibody 25ul