PLA2G6,iPLA2
  • PLA2G6,iPLA2

Anti-PLA2G6 Antibody 100ul

Ref: AN-HPA001171-100ul
Anti-PLA2G6

Información del producto

Polyclonal Antibody against Human PLA2G6, Gene description: phospholipase A2, group VI (cytosolic, calcium-independent), Alternative Gene Names: iPLA2, iPLA2beta, NBIA2, PARK14, PNPLA9, Validated applications: ICC, WB, Uniprot ID: O60733, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PLA2G6
Gene Description phospholipase A2, group VI (cytosolic, calcium-independent)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence QVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMG
Immunogen QVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names iPLA2, iPLA2beta, NBIA2, PARK14, PNPLA9
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60733
HTS Code 3002150000
Gene ID 8398
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PLA2G6 Antibody 100ul

Anti-PLA2G6 Antibody 100ul