A4GALT,A14GALT,Gb3S
  • A4GALT,A14GALT,Gb3S

Anti-A4GALT Antibody 25ul

Ref: AN-HPA001141-25ul
Anti-A4GALT

Información del producto

Polyclonal Antibody against Human A4GALT, Gene description: alpha 1,4-galactosyltransferase, Alternative Gene Names: A14GALT, Gb3S, P(k), Validated applications: ICC, Uniprot ID: Q9NPC4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name A4GALT
Gene Description alpha 1,4-galactosyltransferase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence WEPYLLPVLSDASRIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPRLLSATYAVH
Immunogen WEPYLLPVLSDASRIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPRLLSATYAVH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names A14GALT, Gb3S, P(k)
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NPC4
HTS Code 3002150000
Gene ID 53947
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-A4GALT Antibody 25ul

Anti-A4GALT Antibody 25ul