YY1,DELTA,INO80S
  • YY1,DELTA,INO80S

Anti-YY1 Antibody 25ul

Ref: AN-HPA001119-25ul
Anti-YY1

Información del producto

Polyclonal Antibody against Human YY1, Gene description: YY1 transcription factor, Alternative Gene Names: DELTA, INO80S, NF-E1, UCRBP, YIN-YANG-1, Validated applications: IHC, WB, Uniprot ID: P25490, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name YY1
Gene Description YY1 transcription factor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence DLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTH
Immunogen DLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DELTA, INO80S, NF-E1, UCRBP, YIN-YANG-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P25490
HTS Code 3002150000
Gene ID 7528
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-YY1 Antibody 25ul

Anti-YY1 Antibody 25ul