CEP128,C14orf145
  • CEP128,C14orf145

Anti-CEP128 Antibody 25ul

Ref: AN-HPA001116-25ul
Anti-CEP128

Información del producto

Polyclonal Antibody against Human CEP128, Gene description: centrosomal protein 128kDa, Alternative Gene Names: C14orf145, C14orf61, Validated applications: IHC, Uniprot ID: Q6ZU80, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CEP128
Gene Description centrosomal protein 128kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EEMGSLQDRVIALETSTQVALDHLESVPEKLSLLEDFKDFRDSCSSSERTDGRYSKYRVRRNSLQHHQDDTKYRTKSFKGDRTFLEGSHTRGLDHSSSWQDHSRFLSSPRFSYVNSFTKRTVAPDSASNKEDATMNGTSSQPK
Immunogen EEMGSLQDRVIALETSTQVALDHLESVPEKLSLLEDFKDFRDSCSSSERTDGRYSKYRVRRNSLQHHQDDTKYRTKSFKGDRTFLEGSHTRGLDHSSSWQDHSRFLSSPRFSYVNSFTKRTVAPDSASNKEDATMNGTSSQPK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C14orf145, C14orf61
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZU80
HTS Code 3002150000
Gene ID 145508
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CEP128 Antibody 25ul

Anti-CEP128 Antibody 25ul