KHDRBS3,Etle,etoile
  • KHDRBS3,Etle,etoile

Anti-KHDRBS3 Antibody 25ul

Ref: AN-HPA000981-25ul
Anti-KHDRBS3

Información del producto

Polyclonal Antibody against Human KHDRBS3, Gene description: KH domain containing, RNA binding, signal transduction associated 3, Alternative Gene Names: Etle, etoile, SALP, SLM-2, SLM2, T-STAR, Validated applications: ICC, WB, Uniprot ID: O75525, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KHDRBS3
Gene Description KH domain containing, RNA binding, signal transduction associated 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence ADVPVVRGKPTLRTRGVPAPAITRGRGGVTARPVGVVVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDS
Immunogen ADVPVVRGKPTLRTRGVPAPAITRGRGGVTARPVGVVVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Etle, etoile, SALP, SLM-2, SLM2, T-STAR
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75525
HTS Code 3002150000
Gene ID 10656
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KHDRBS3 Antibody 25ul

Anti-KHDRBS3 Antibody 25ul