AHSA1,C14orf3,p38
  • AHSA1,C14orf3,p38

Anti-AHSA1 Antibody 25ul

Ref: AN-HPA000903-25ul
Anti-AHSA1

Información del producto

Polyclonal Antibody against Human AHSA1, Gene description: AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast), Alternative Gene Names: C14orf3, p38, Validated applications: ICC, IHC, WB, Uniprot ID: O95433, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name AHSA1
Gene Description AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence PTMNGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTSPEELYRVFTTQELVQAFTHAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEEE
Immunogen PTMNGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTSPEELYRVFTTQELVQAFTHAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEEE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C14orf3, p38
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95433
HTS Code 3002150000
Gene ID 10598
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-AHSA1 Antibody 25ul

Anti-AHSA1 Antibody 25ul