HSPA9,GRP75,HSPA9B
  • HSPA9,GRP75,HSPA9B

Anti-HSPA9 Antibody 100ul

Ref: AN-HPA000898-100ul
Anti-HSPA9

Información del producto

Polyclonal Antibody against Human HSPA9, Gene description: heat shock 70kDa protein 9 (mortalin), Alternative Gene Names: GRP75, HSPA9B, mot-2, mthsp75, PBP74, Validated applications: ICC, IHC, WB, Uniprot ID: P38646, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HSPA9
Gene Description heat shock 70kDa protein 9 (mortalin)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence GIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGT
Immunogen GIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GRP75, HSPA9B, mot-2, mthsp75, PBP74
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P38646
HTS Code 3002150000
Gene ID 3313
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HSPA9 Antibody 100ul

Anti-HSPA9 Antibody 100ul