CCDC22,CXorf37,JM1
  • CCDC22,CXorf37,JM1

Anti-CCDC22 Antibody 100ul

Ref: AN-HPA000888-100ul
Anti-CCDC22

Información del producto

Polyclonal Antibody against Human CCDC22, Gene description: coiled-coil domain containing 22, Alternative Gene Names: CXorf37, JM1, Validated applications: ICC, IHC, WB, Uniprot ID: O60826, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CCDC22
Gene Description coiled-coil domain containing 22
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, ICC, WB
Sequence YQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPAGDSAILLRAIGSQIRDQLALPWVPPHLRTPKLQHLQGSALQKPFHASRLVVPELSSRGEPREFQASPLLLPVPTQVPQPVGRVA
Immunogen YQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPAGDSAILLRAIGSQIRDQLALPWVPPHLRTPKLQHLQGSALQKPFHASRLVVPELSSRGEPREFQASPLLLPVPTQVPQPVGRVA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CXorf37, JM1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60826
HTS Code 3002150000
Gene ID 28952
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CCDC22 Antibody 100ul

Anti-CCDC22 Antibody 100ul