SYNJ2BP,Arip2
  • SYNJ2BP,Arip2

Anti-SYNJ2BP Antibody 25ul

Ref: AN-HPA000866-25ul
Anti-SYNJ2BP

Información del producto

Polyclonal Antibody against Human SYNJ2BP, Gene description: synaptojanin 2 binding protein, Alternative Gene Names: Arip2, Validated applications: ICC, IHC, WB, Uniprot ID: P57105, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SYNJ2BP
Gene Description synaptojanin 2 binding protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications ICC, IHC, WB
Sequence NGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEG
Immunogen NGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Arip2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P57105
HTS Code 3002150000
Gene ID 55333
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SYNJ2BP Antibody 25ul

Anti-SYNJ2BP Antibody 25ul